84229
330830
ENSG00000159625
ENSMUSG00000031786
Q8IY82
Q6V3W6
NM_001289162NM_001289163NM_032269
NM_001042715
NP_001276091NP_001276092NP_115645
NP_001036180
Coiled-coil domain-containing protein 135, also known as CCDC135, is a protein that in humans is encoded by the CCDC135 gene.[5][6]
CCDC90B is located on chromosome 16 in humans. It is neighbored by:[7]
This protein is characterized by the presence of two domains.[8]
KKQQEIRAQEKKRLR
CAQFVSDFLTMVPLPDPLKPPSHLYSSTTVLKYQKGNCFDFSTLLCSMLIGSGYDAYCVNGYGSLDLCHMDLTREVCPLTVKPKETIKKEEK VLPKKYTIKPPRDLCSRFEQEQEVKKQQEIRAQEKKRLREEEERLMEAEKAKPDALHGLRVHSWVLVL
The protein has 17 predicted alpha helices sites, a characteristic of coiled-coil proteins, and 1 predicted beta-pleated sheet. The following image shows the predicted regions of alpha helices and beta pleated sheets by two programs STRAP[9] and Quickphyre:[10] Note: the consensus secondary structures are shown. This was carried out by constructing a multiple sequence alignment of the proteins with their secondary structures (as shown below). The predicted regions were then cross checked with the Quickphyre Archived 30 April 2017 at the Wayback Machine Program.
LRRC57 is exceedingly well conserved, as shown in the sequence annotation to the right. The sequence annotation was created using 20 orthologs shown in the table below and was prepared using ClustalX2[11] and ClustalW (a tool at Biology Workbench).[12]
The following table provides a few details on orthologs of the human version of CCDC135. These orthologs were gathered from BLAT.[13] and BLAST searches[14]
CCDC135 is predicted to be a Cytosol/Nuclear protein[17] with no transmembrane spans or segments. It is predicted to contain at least 56 specific phosphorylation sites[18] which include: 20 Protein Kinase C Phosphorylation sites, 11 Casein Kinase II Phosphorylation sites, and 8 cAMP/cGMP Dependent Phosphorylation sites. The amino acid sequence is also predicted to contain 10 sumoylation[19] sites at positions K236, K236, K45, K773, K499, K679, K249, K167, K540, K445, and K292.
The function of CCDC135 is not yet well understood but it is thought to be involved in teratospermia.[dubious – discuss][citation needed]
